PDB entry 3f1g

View 3f1g on RCSB PDB site
Description: Crystal structure of a translation termination complex formed with release factor RF2. This file contains the 30S subunit, RF2, two tRNA, and mRNA molecules of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
Class: ribosome
Keywords: rf2, ribosome, termination, tRNA
Deposited on 2008-10-27, released 2008-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.281
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16s rRNA
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'B':
    Compound: 30S ribosomal protein S2
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 30S ribosomal protein S3
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 30S ribosomal protein S4
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 30S ribosomal protein S5
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 30S ribosomal protein S6
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 30S ribosomal protein S7
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 30S ribosomal protein S8
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 30S ribosomal protein S9
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 30S ribosomal protein S10
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 30S ribosomal protein S11
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 30S ribosomal protein S12
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 30S ribosomal protein S13
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 30S ribosomal protein S14
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 30S ribosomal protein S15
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 30S ribosomal protein S16
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 30S ribosomal protein S17
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 30S ribosomal protein S18
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 30S ribosomal protein S19
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 30S ribosomal protein S20
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 30S ribosomal protein Thx
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: mRNA
  • Chain 'X':
    Compound: Bacterial peptide chain release factor 2 (RF-2)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f1gx_
  • Chain 'Y':
    Compound: P and E-site tRNA(fMet)
    Species: Escherichia coli [TaxId:562]
  • Chain 'Z':
    Compound: P and E-site tRNA(fMet)
    Species: Escherichia coli [TaxId:562]
  • Heterogens: ZN, MG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3f1gX (X:)
    mrlasqsailvkvwtwnasrnawkasggifdipqketrlkelerrledpslwndpeaark
    vsqeaarlrrtvdtfrslesdlqgllelmeelpaeerealkpeleeaakkldelyhqtll
    nfphaeknailtiqpgaggteacdwaemllrmytrfaerqgfqvevvdltpgpeagidya
    qilvkgenaygllspeagvhrlvrpspfdasgrrhtsfagvevipevdeevevvlkpeel
    ridvmrasgpggqgvnttdsavrvvhlptgitvtcqttrsqiknkelalkilkarlyele
    rkkreeelkalrgevrpiewgsqirsyvldknyvkdhrtglmrhdpenvldgdlmdliwa
    glewkagrrqgteeveae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f1gX (X:)
    nasrnawkasggifdipqketrlkelerrledpslwndpeaarkvsqeaarlrrtvdtfr
    slesdlqgllelmeelpaeerealkpeleeaakkldelyhqtllnfphaeknailtiqpg
    aggteacdwaemllrmytrfaerqgfqvevvdltpgpeagidyaqilvkgenaygllspe
    agvhrlvrpspfdasgrrhtsfagvevipevdeevevvlkpeelridvmrasgpggqgvn
    ttdsavrvvhlptgitvtcqttrsqiknkelalkilkarlyelerkkreeelkalrgevr
    piewgsqirsyvldknyvkdhrtglmrhdpenvldgdlmdliwaglewkagrrqgteeve
    ae
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.