PDB entry 3f1g

View 3f1g on RCSB PDB site
Description: Crystal structure of a translation termination complex formed with release factor RF2. This file contains the 30S subunit, RF2, two tRNA, and mRNA molecules of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
Class: ribosome
Keywords: rf2, ribosome, termination, tRNA
Deposited on 2008-10-27, released 2008-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.281
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 16s rRNA
  Species: Thermus thermophilus [TaxId:274]
  
• Chain 'B':
  Compound: 30S ribosomal protein S2
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62662
• Chain 'C':
  Compound: 30S ribosomal protein S3
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62663
• Chain 'D':
  Compound: 30S ribosomal protein S4
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62664 (Start-208)
• Chain 'E':
  Compound: 30S ribosomal protein S5
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62665
• Chain 'F':
  Compound: 30S ribosomal protein S6
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62666 (0-100)
• Chain 'G':
  Compound: 30S ribosomal protein S7
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62667 (Start-155)
• Chain 'H':
  Compound: 30S ribosomal protein S8
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62668 (0-137)
• Chain 'I':
  Compound: 30S ribosomal protein S9
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62669 (Start-127)
• Chain 'J':
  Compound: 30S ribosomal protein S10
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62653
• Chain 'K':
  Compound: 30S ribosomal protein S11
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62654
• Chain 'L':
  Compound: 30S ribosomal protein S12
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61941
• Chain 'M':
  Compound: 30S ribosomal protein S13
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62655
• Chain 'N':
  Compound: 30S ribosomal protein S14
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62656 (Start-60)
• Chain 'O':
  Compound: 30S ribosomal protein S15
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62657 (Start-88)
• Chain 'P':
  Compound: 30S ribosomal protein S16
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62238 (0-End)
• Chain 'Q':
  Compound: 30S ribosomal protein S17
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62658
• Chain 'R':
  Compound: 30S ribosomal protein S18
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62659 (Start-87)
• Chain 'S':
  Compound: 30S ribosomal protein S19
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62660
• Chain 'T':
  Compound: 30S ribosomal protein S20
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62661 (Start-105)
• Chain 'U':
  Compound: 30S ribosomal protein Thx
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62613
• Chain 'V':
  Compound: mRNA
  
• Chain 'X':
  Compound: Bacterial peptide chain release factor 2 (RF-2)
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q72GJ6 (Start-377)
  Domains in SCOPe 2.08: d3f1gx_
• Chain 'Y':
  Compound: P and E-site tRNA(fMet)
  Species: Escherichia coli [TaxId:562]
  
• Chain 'Z':
  Compound: P and E-site tRNA(fMet)
  Species: Escherichia coli [TaxId:562]
  
• Heterogens: ZN, MG

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.
  
  
• Chain 'T':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'V':
  No sequence available.
  
  
• Chain 'X':
  Sequence, based on SEQRES records: (download)
  

  >3f1gX (X:)
  mrlasqsailvkvwtwnasrnawkasggifdipqketrlkelerrledpslwndpeaark
  vsqeaarlrrtvdtfrslesdlqgllelmeelpaeerealkpeleeaakkldelyhqtll
  nfphaeknailtiqpgaggteacdwaemllrmytrfaerqgfqvevvdltpgpeagidya
  qilvkgenaygllspeagvhrlvrpspfdasgrrhtsfagvevipevdeevevvlkpeel
  ridvmrasgpggqgvnttdsavrvvhlptgitvtcqttrsqiknkelalkilkarlyele
  rkkreeelkalrgevrpiewgsqirsyvldknyvkdhrtglmrhdpenvldgdlmdliwa
  glewkagrrqgteeveae
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3f1gX (X:)
  nasrnawkasggifdipqketrlkelerrledpslwndpeaarkvsqeaarlrrtvdtfr
  slesdlqgllelmeelpaeerealkpeleeaakkldelyhqtllnfphaeknailtiqpg
  aggteacdwaemllrmytrfaerqgfqvevvdltpgpeagidyaqilvkgenaygllspe
  agvhrlvrpspfdasgrrhtsfagvevipevdeevevvlkpeelridvmrasgpggqgvn
  ttdsavrvvhlptgitvtcqttrsqiknkelalkilkarlyelerkkreeelkalrgevr
  piewgsqirsyvldknyvkdhrtglmrhdpenvldgdlmdliwaglewkagrrqgteeve
  ae
  

  
  
• Chain 'Y':
  No sequence available.
  
  
• Chain 'Z':
  No sequence available.