PDB entry 3f1e
View 3f1e on RCSB PDB site
Description: Crystal structure of a translation termination complex formed with release factor RF2. This file contains the 30S subunit, RF2, two tRNA, and mRNA molecules of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
Class: ribosome
Keywords: rf2, ribosome, termination, tRNA
Deposited on
2008-10-27, released
2008-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated
2014-12-10, with a file datestamp of
2014-12-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.281
AEROSPACI score: 0.08
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 16s rRNA
Species: Thermus thermophilus [TaxId:274]
- Chain 'B':
Compound: 30S ribosomal protein S2
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: 30S ribosomal protein S3
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: 30S ribosomal protein S4
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: 30S ribosomal protein S5
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: 30S ribosomal protein S6
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: 30S ribosomal protein S7
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: 30S ribosomal protein S8
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: 30S ribosomal protein S9
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: 30S ribosomal protein S10
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: 30S ribosomal protein S11
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: 30S ribosomal protein S12
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: 30S ribosomal protein S13
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'N':
Compound: 30S ribosomal protein S14
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'O':
Compound: 30S ribosomal protein S15
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'P':
Compound: 30S ribosomal protein S16
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'Q':
Compound: 30S ribosomal protein S17
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'R':
Compound: 30S ribosomal protein S18
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'S':
Compound: 30S ribosomal protein S19
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'T':
Compound: 30S ribosomal protein S20
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'U':
Compound: 30S ribosomal protein Thx
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'V':
Compound: mRNA
- Chain 'X':
Compound: Bacterial peptide chain release factor 2 (RF-2)
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3f1ex_ - Chain 'Y':
Compound: P and E-site tRNA(fMet)
Species: Escherichia coli [TaxId:562]
- Chain 'Z':
Compound: P and E-site tRNA(fMet)
Species: Escherichia coli [TaxId:562]
- Heterogens: ZN, MG
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
No sequence available.
- Chain 'L':
No sequence available.
- Chain 'M':
No sequence available.
- Chain 'N':
No sequence available.
- Chain 'O':
No sequence available.
- Chain 'P':
No sequence available.
- Chain 'Q':
No sequence available.
- Chain 'R':
No sequence available.
- Chain 'S':
No sequence available.
- Chain 'T':
No sequence available.
- Chain 'U':
No sequence available.
- Chain 'V':
No sequence available.
- Chain 'X':
Sequence, based on SEQRES records: (download)
>3f1eX (X:)
mrlasqsailvkvwtwnasrnawkasggifdipqketrlkelerrledpslwndpeaark
vsqeaarlrrtvdtfrslesdlqgllelmeelpaeerealkpeleeaakkldelyhqtll
nfphaeknailtiqpgaggteacdwaemllrmytrfaerqgfqvevvdltpgpeagidya
qilvkgenaygllspeagvhrlvrpspfdasgrrhtsfagvevipevdeevevvlkpeel
ridvmrasgpggqgvnttdsavrvvhlptgitvtcqttrsqiknkelalkilkarlyele
rkkreeelkalrgevrpiewgsqirsyvldknyvkdhrtglmrhdpenvldgdlmdliwa
glewkagrrqgteeveae
Sequence, based on observed residues (ATOM records): (download)
>3f1eX (X:)
nasrnawkasggifdipqketrlkelerrledpslwndpeaarkvsqeaarlrrtvdtfr
slesdlqgllelmeelpaeerealkpeleeaakkldelyhqtllnfphaeknailtiqpg
aggteacdwaemllrmytrfaerqgfqvevvdltpgpeagidyaqilvkgenaygllspe
agvhrlvrpspfdasgrrhtsfagvevipevdeevevvlkpeelridvmrasgpggqgvn
ttdsavrvvhlptgitvtcqttrsqiknkelalkilkarlyelerkkreeelkalrgevr
piewgsqirsyvldknyvkdhrtglmrhdpenvldgdlmdliwaglewkagrrqgteeve
ae
- Chain 'Y':
No sequence available.
- Chain 'Z':
No sequence available.