PDB entry 3f0x

View 3f0x on RCSB PDB site
Description: Staphylococcus aureus F98Y mutant dihydrofolate reductase complexed with NADPH and 2,4-Diamino-5-[3-(3-methoxy-5-(3,5-dimethylphenyl)phenyl)but-1-ynyl]-6-methylpyrimidine
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2008-10-27, released 2009-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Trimethoprim-sensitive dihydrofolate reductase
    Species: Staphylococcus aureus RF122 [TaxId:273036]
    Gene: dfrB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YY41 (0-156)
      • engineered (97)
    Domains in SCOPe 2.07: d3f0xx_
  • Heterogens: NDP, 53T, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3f0xX (X:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirk