PDB entry 3f0q

View 3f0q on RCSB PDB site
Description: Staphylococcus aureus dihydrofolate reductase complexed with NADPH and 2,4-Diamino-5-[3-(3-methoxy-5-(2,6-dimethylphenyl)phenyl)but-1-ynyl]-6-methylpyrimidine
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2008-10-25, released 2009-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.196
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Trimethoprim-sensitive dihydrofolate reductase
  Species: Staphylococcus aureus RF122 [TaxId:273036]
  Gene: dfrB
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2YY41 (0-156)
  Domains in SCOPe 2.08: d3f0qx_
• Heterogens: NDP, 52V, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3f0qX (X:)
  tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
  vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
  tffppytfedwevassvegkldekntiphtflhlirk