PDB entry 3f0n

View 3f0n on RCSB PDB site
Description: Mus Musculus Mevalonate Pyrophosphate Decarboxylase
Class: lyase
Keywords: cholesterol biosynthesis, lipid synthesis, lyase, steroid biosynthesis, sterol biosynthesis, structural genomics, structural genomics consortium, sgc;
Deposited on 2008-10-25, released 2008-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mevalonate pyrophosphate decarboxylase
    Species: Mus musculus [TaxId:10090]
    Gene: MVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JF5
      • expression tag (10-15)
      • variant (308)
      • variant (372)
    Domains in SCOPe 2.05: d3f0na1, d3f0na2
  • Chain 'B':
    Compound: mevalonate pyrophosphate decarboxylase
    Species: Mus musculus [TaxId:10090]
    Gene: MVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JF5
      • variant (308)
      • variant (372)
    Domains in SCOPe 2.05: d3f0nb1, d3f0nb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f0nA (A:)
    mhhhhhhssgrenlyfqgpqdlmvtctapvniavikywgkrdealilpinsslsvtlhqd
    qlkttttvaiskdftedriwlngreedvgqprlqaclreirrlarkrrstedgdtlplsl
    sykvhvasvnnfptaaglassaagyaclaytlaqvygvegdlsevarrgsgsacrslygg
    fvewqmgeqadgkdsiarqiapewhwpqlrililvvsadkkqtgstvgmqtsvetstllk
    fraesvvpermkemtrciqeqdfqgfaqltmkdsnqfhatcldtfppisylndtsrriiq
    lvhrfnthhgqtkvaytfdagpnaviftledtvaefvaavrhsfppaangdkflkglqva
    pvllsdelkaalvvepspggvqyiiatqvgpgpqvlddthdhllgqdglpqrdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f0nA (A:)
    renlyfdlmvtctapvniavikywgkrdealilpinsslsvtlhqdqlkttttvaiskdf
    tedriwlngreedvgqprlqaclreirrlarkdtlplslsykvhvasvnnfptaaglass
    aagyaclaytlaqvygvegdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqia
    pewhwpqlrililvvsadkqtgstvgmqtsvetstllkfraesvvpermkemtrciqeqd
    fqgfaqltmkdsnqfhatcldtfppisylndtsrriiqlvhrfnthhgqtkvaytfdagp
    naviftledtvaefvaavrhsfppaankflkglqvapvllsdelkaalvvepspggvqyi
    iatqvgpgpqvlddthdhllgqdglpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f0nB (B:)
    mhhhhhhssgrenlyfqgpqdlmvtctapvniavikywgkrdealilpinsslsvtlhqd
    qlkttttvaiskdftedriwlngreedvgqprlqaclreirrlarkrrstedgdtlplsl
    sykvhvasvnnfptaaglassaagyaclaytlaqvygvegdlsevarrgsgsacrslygg
    fvewqmgeqadgkdsiarqiapewhwpqlrililvvsadkkqtgstvgmqtsvetstllk
    fraesvvpermkemtrciqeqdfqgfaqltmkdsnqfhatcldtfppisylndtsrriiq
    lvhrfnthhgqtkvaytfdagpnaviftledtvaefvaavrhsfppaangdkflkglqva
    pvllsdelkaalvvepspggvqyiiatqvgpgpqvlddthdhllgqdglpqrdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f0nB (B:)
    dlmvtctapvniavikywgkrdealilpinsslsvtlhqdqlkttttvaiskdftedriw
    lngreedvgqprlqaclreirrlarkrrlslsykvhvasvnnfpassaagyaclaytlaq
    vygvegdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqiapewhwpqlrilil
    vvsadkkqtgstvgmqtsvetstllkfraesvvpermkemtrciqeqdfqgfaqltmkds
    nqfhatcldtfppisylndtsrriiqlvhrfnthhgqtkvaytfdagpnaviftledtva
    efvaavrhsfppaankflkglqvapvllsdelkaalvpspggvqyiiatqvgpgpqvldd
    thdhllgqdglpq