PDB entry 3f0h

View 3f0h on RCSB PDB site
Description: Crystal structure of Aminotransferase (RER070207000802) from Eubacterium rectale at 1.70 A resolution
Class: transferase
Keywords: RER070207000802, Aminotransferase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Aminotransferase class-V, TRANSFERASE
Deposited on 2008-10-24, released 2008-11-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.148
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase
    Species: Eubacterium rectale
    Gene: RER070207000802
    Database cross-references and differences (RAF-indexed):
    • PDB 3F0H (Start-375)
    Domains in SCOPe 2.05: d3f0ha_
  • Heterogens: UNL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f0hA (A:)
    mgsdkihhhhhhenlyfqgmlnftvgpvmsseevraigaeqvpyfrttefsstmlenekf
    mleyakapegskavfmtcsstgsmeavvmncftkkdkvlvidggsfghrfvqlceiheip
    yvalklehgkkltkeklyeydnqnftgllvnvdetstavlydtmmigefckknnmffvcd
    cvsafladpfnmnecgadvmitgsqkvlacppgisvivlaprgvervekskvrtmyfdlk
    dalknqergqtpftpavgillqinerlkeikkhggadaevariasqaadfrakikdlpfe
    lvsespangvtsvhpttanaydiflklkdeygiwicpnggemkdtifrvghigalthedn
    ttlvnafkdlqkrnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f0hA (A:)
    lyfqgmlnftvgpvmsseevraigaeqvpyfrttefsstmlenekfmleyakapegskav
    fmtcsstgsmeavvmncftkkdkvlvidggsfghrfvqlceiheipyvalklehgkkltk
    eklyeydnqnftgllvnvdetstavlydtmmigefckknnmffvcdcvsafladpfnmne
    cgadvmitgsqkvlacppgisvivlaprgvervekskvrtmyfdlkdalknqergqtpft
    pavgillqinerlkeikkhggadaevariasqaadfrakikdlpfelvsespangvtsvh
    pttanaydiflklkdeygiwicpnggemkdtifrvghigalthednttlvnafkdlqkrn
    ll