PDB entry 3f03

View 3f03 on RCSB PDB site
Description: Crystal structure of Pentaerythritol Tetranitrate Reductase complex with 1-nitrocyclohexene
Class: oxidoreductase
Keywords: Asymmetric hydrogenatio, bioreduction, biocatalysis, nitroalkenes, pentaerythritol tetranitrate reductase, stereo-control, OXIDOREDUCTASE
Deposited on 2008-10-24, released 2008-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-16, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.116
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'K':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: onr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f03k_
  • Heterogens: NYH, FMN, CL, IPA, HOH

PDB Chain Sequences:

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3f03K (K:)
    saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
    isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
    sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
    hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
    qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
    gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
    ypsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f03K (K:)
    eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
    aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
    salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
    ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
    vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
    ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
    sl