PDB entry 3f00

View 3f00 on RCSB PDB site
Description: Crystal Structure of Synaptotagmin I C2A domain with Cu(II)
Class: metal binding protein
Keywords: Synaptotagmin I, C2A, copper, METAL BINDING PROTEIN
Deposited on 2008-10-24, released 2009-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: 0.203
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SYT1, SVP65, SYT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21579 (17-142)
      • expression tag (0-16)
    Domains in SCOPe 2.06: d3f00a1, d3f00a2
  • Heterogens: CU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3f00A (A:)
    gspgiggggggildsmveklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvk
    vfllpdkkkkfetkvhrktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiige
    fkvpmntvdfghvteewrdlqsa