PDB entry 3f00

View 3f00 on RCSB PDB site
Description: Crystal Structure of Synaptotagmin I C2A domain with Cu(II)
Class: metal binding protein
Keywords: Synaptotagmin I, C2A, copper, METAL BINDING PROTEIN
Deposited on 2008-10-24, released 2009-09-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Synaptotagmin-1
  Species: Homo sapiens [TaxId:9606]
  Gene: SYT1, SVP65, SYT
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21579 (17-142)
    • expression tag (0-16)
  Domains in SCOPe 2.08: d3f00a1, d3f00a2
• Heterogens: CU, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3f00A (A:)
  gspgiggggggildsmveklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvk
  vfllpdkkkkfetkvhrktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiige
  fkvpmntvdfghvteewrdlqsa