PDB entry 3ezs

View 3ezs on RCSB PDB site
Description: Crystal structure of aminotransferase AspB (NP_207418.1) from HELICOBACTER PYLORI 26695 at 2.19 A resolution
Class: transferase
Keywords: NP_207418.1, aminotransferase AspB, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Aminotransferase class I and II, TRANSFERASE
Deposited on 2008-10-23, released 2008-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminotransferase AspB
    Species: Helicobacter pylori 26695 [TaxId:85962]
    Gene: NP_207418.1, HP_0624
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25341 (1-End)
      • leader sequence (0)
    Domains in SCOPe 2.07: d3ezsa1, d3ezsa2
  • Chain 'B':
    Compound: aminotransferase AspB
    Species: Helicobacter pylori 26695 [TaxId:85962]
    Gene: NP_207418.1, HP_0624
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ezsb_
  • Heterogens: PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ezsA (A:)
    gmtfepypferlrallkeitpkkrgldlgigepqfetpkfiqdalknhthslniypksaf
    eeslraaqrgffkrrfkielkenelistlgsrevlfnfpsfvlfdyqnptiaypnpfyqi
    yegaakfikaksllmpltkendftpslnekelqevdlvilnspnnptgrtlsleeliswv
    klalkhdfilindecyseiyentpppslleacmlagneafknvlvihslskrssapglrs
    gfiagdsrllekykafraylgytsanaiqkaseaawlddrhaeffrniyannlklarkif
    kntliypysfyvylpvqngenfaktlyqnegiitlpalylgrnrigadyvrlalvydtpl
    lekpleiietyrenha
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezsA (A:)
    gmtfepypferlrallkeitpkkrgldlgigepqfetpkfiqdalknhthslniypksaf
    eeslraaqrgffkrrfkielkenelistlgsrevlfnfpsfvlfdyqnptiaypnpfyqi
    yegaakfikaksllmpltkendftpslnekelqevdlvilnspnnptgrtlsleeliswv
    klalkhdfilindecyseiyentpppslleacmlagneafknvlvihslskrssapglrs
    gfiagdsrllekykafraylgytsanaiqkaseaawlddrhaeffrniyannlklarkif
    kntliypysfyvylpvqngenfaktlyqnegiitlpalylgrnrigadyvrlalvydtpl
    lekpleiietyren
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ezsB (B:)
    gmtfepypferlrallkeitpkkrgldlgigepqfetpkfiqdalknhthslniypksaf
    eeslraaqrgffkrrfkielkenelistlgsrevlfnfpsfvlfdyqnptiaypnpfyqi
    yegaakfikaksllmpltkendftpslnekelqevdlvilnspnnptgrtlsleeliswv
    klalkhdfilindecyseiyentpppslleacmlagneafknvlvihslskrssapglrs
    gfiagdsrllekykafraylgytsanaiqkaseaawlddrhaeffrniyannlklarkif
    kntliypysfyvylpvqngenfaktlyqnegiitlpalylgrnrigadyvrlalvydtpl
    lekpleiietyrenha
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezsB (B:)
    mtfepypferlrallkeitpkkrgldlgigepqfetpkfiqdalknhthslniypksafe
    eslraaqrgffkrrfkielkenelistlgsrevlfnfpsfvlfdyqnptiaypnpfyqiy
    egaakfikaksllmpltkendftpslnekelqevdlvilnspnnptgrtlsleeliswvk
    lalkhdfilindecyseiyentpppslleacmlagneafknvlvihslskrssapglrsg
    fiagdsrllekykafraylgytsanaiqkaseaawlddrhaeffrniyannlklarkifk
    ntliypysfyvylpvqngenfaktlyqnegiitlpalylgrnrigadyvrlalvydtpll
    ekpleiietyrenh