PDB entry 3ezq

View 3ezq on RCSB PDB site
Description: Crystal Structure of the Fas/FADD Death Domain Complex
Class: apoptosis
Keywords: Apoptosis, DISC, FAS, FADD, Membrane,receptor, Transmembrane
Deposited on 2008-10-23, released 2008-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: 0.236
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor receptor superfamily member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: FAS, APT1, FAS1, TNFRSF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25445 (0-112)
      • expression tag (113-114)
    Domains in SCOPe 2.06: d3ezqa1, d3ezqa2
  • Chain 'B':
    Compound: Protein FADD
    Species: Homo sapiens [TaxId:9606]
    Gene: FADD, MORT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ezqb_
  • Chain 'C':
    Compound: Tumor necrosis factor receptor superfamily member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: FAS, APT1, FAS1, TNFRSF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25445 (0-112)
      • expression tag (113-114)
    Domains in SCOPe 2.06: d3ezqc1, d3ezqc2
  • Chain 'D':
    Compound: Protein FADD
    Species: Homo sapiens [TaxId:9606]
    Gene: FADD, MORT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ezqd_
  • Chain 'E':
    Compound: Tumor necrosis factor receptor superfamily member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: FAS, APT1, FAS1, TNFRSF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25445 (0-112)
      • expression tag (113-114)
    Domains in SCOPe 2.06: d3ezqe1, d3ezqe2
  • Chain 'F':
    Compound: Protein FADD
    Species: Homo sapiens [TaxId:9606]
    Gene: FADD, MORT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ezqf_
  • Chain 'G':
    Compound: Tumor necrosis factor receptor superfamily member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: FAS, APT1, FAS1, TNFRSF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25445 (0-112)
      • expression tag (113-114)
    Domains in SCOPe 2.06: d3ezqg1, d3ezqg2
  • Chain 'H':
    Compound: Protein FADD
    Species: Homo sapiens [TaxId:9606]
    Gene: FADD, MORT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ezqh_
  • Chain 'I':
    Compound: Tumor necrosis factor receptor superfamily member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: FAS, APT1, FAS1, TNFRSF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25445 (0-112)
      • expression tag (113-114)
    Domains in SCOPe 2.06: d3ezqi1, d3ezqi2
  • Chain 'J':
    Compound: Protein FADD
    Species: Homo sapiens [TaxId:9606]
    Gene: FADD, MORT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ezqj_
  • Chain 'K':
    Compound: Tumor necrosis factor receptor superfamily member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: FAS, APT1, FAS1, TNFRSF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25445 (0-112)
      • expression tag (113-114)
    Domains in SCOPe 2.06: d3ezqk1, d3ezqk2
  • Chain 'L':
    Compound: Protein FADD
    Species: Homo sapiens [TaxId:9606]
    Gene: FADD, MORT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ezql_
  • Chain 'M':
    Compound: Tumor necrosis factor receptor superfamily member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: FAS, APT1, FAS1, TNFRSF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25445 (0-112)
      • expression tag (113-114)
    Domains in SCOPe 2.06: d3ezqm1, d3ezqm2
  • Chain 'N':
    Compound: Protein FADD
    Species: Homo sapiens [TaxId:9606]
    Gene: FADD, MORT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ezqn_
  • Chain 'O':
    Compound: Tumor necrosis factor receptor superfamily member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: FAS, APT1, FAS1, TNFRSF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25445 (0-112)
      • expression tag (113-114)
    Domains in SCOPe 2.06: d3ezqo1, d3ezqo2
  • Chain 'P':
    Compound: Protein FADD
    Species: Homo sapiens [TaxId:9606]
    Gene: FADD, MORT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ezqp_
  • Heterogens: SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezqA (A:)
    nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
    qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ezqB (B:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsgamspmswnsdastseashhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezqB (B:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezqC (C:)
    nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
    qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ezqD (D:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsgamspmswnsdastseashhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezqD (D:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezqE (E:)
    nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
    qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ezqF (F:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsgamspmswnsdastseashhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezqF (F:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezqG (G:)
    nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
    qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvle
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ezqH (H:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsgamspmswnsdastseashhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezqH (H:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezqI (I:)
    nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
    qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvle
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ezqJ (J:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsgamspmswnsdastseashhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezqJ (J:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezqK (K:)
    nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
    qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvle
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ezqL (L:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsgamspmswnsdastseashhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezqL (L:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezqM (M:)
    nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
    qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvle
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3ezqN (N:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsgamspmswnsdastseashhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezqN (N:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezqO (O:)
    nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
    qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvle
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3ezqP (P:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsgamspmswnsdastseashhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ezqP (P:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqardlqnrsg