PDB entry 3eza

View 3eza on RCSB PDB site
Description: complex of the amino terminal domain of enzyme I and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Class: complex (transferase/phosphocarrier)
Keywords: phosphotransferase, transferase, kinase, sugar transport, complex (transferase/phosphocarrier)
Deposited on 1998-11-03, released 1999-05-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotransferase system, enzyme I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ezaa1, d3ezaa2
  • Chain 'B':
    Compound: histidine-containing phosphocarrier protein hpr
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA04 (0-84)
      • conflict (62)
    Domains in SCOPe 2.03: d3ezab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezaA (A:)
    misgilaspgiafgkalllkedeividrkkisadqvdqeverflsgrakasaqletiktk
    agetfgeekeaifeghimlledeeleqeiialikdkhmtadaaaheviegqasaleeldd
    eylkeraadvrdigkrllrnilglkiidlsaiqdevilvaadltpsetaqlnlkkvlgfi
    tdaggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmr
    avqeqvase
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezaB (B:)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele