PDB entry 3eza

View 3eza on RCSB PDB site
Description: complex of the amino terminal domain of enzyme i and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Deposited on 1998-11-03, released 1999-05-25
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-25, with a file datestamp of 1999-05-24.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezaA (A:)
    misgilaspgiafgkalllkedeividrkkisadqvdqeverflsgrakasaqletiktk
    agetfgeekeaifeghimlledeeleqeiialikdkhmtadaaaheviegqasaleeldd
    eylkeraadvrdigkrllrnilglkiidlsaiqdevilvaadltpsetaqlnlkkvlgfi
    tdaggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmr
    avqeqvase
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ezaB (B:)
    mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
    vtisaegedeqkavehlvklmaele