PDB entry 3ez4

View 3ez4 on RCSB PDB site
Description: Crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from Burkholderia pseudomallei
Class: transferase
Keywords: Cytoplasm, Magnesium, Metal-binding, Methyltransferase, Pantothenate biosynthesis, Transferase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2008-10-22, released 2008-11-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: 721, 76, 808, BPSL2824, panB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63R49 (9-268)
      • expression tag (7-8)
    Domains in SCOPe 2.04: d3ez4a_
  • Chain 'B':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: 721, 76, 808, BPSL2824, panB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63R49 (9-268)
      • expression tag (8)
    Domains in SCOPe 2.04: d3ez4b_
  • Chain 'C':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: 721, 76, 808, BPSL2824, panB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63R49 (9-268)
      • expression tag (7-8)
    Domains in SCOPe 2.04: d3ez4c_
  • Chain 'D':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: 721, 76, 808, BPSL2824, panB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63R49 (9-End)
      • expression tag (6-8)
    Domains in SCOPe 2.04: d3ez4d_
  • Chain 'E':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: 721, 76, 808, BPSL2824, panB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63R49 (9-268)
      • expression tag (7-8)
    Domains in SCOPe 2.04: d3ez4e_
  • Chain 'F':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: 721, 76, 808, BPSL2824, panB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63R49 (9-268)
      • expression tag (6-8)
    Domains in SCOPe 2.04: d3ez4f_
  • Chain 'G':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: 721, 76, 808, BPSL2824, panB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63R49 (9-268)
      • expression tag (8)
    Domains in SCOPe 2.04: d3ez4g_
  • Chain 'H':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: 721, 76, 808, BPSL2824, panB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63R49 (9-268)
      • expression tag (7-8)
    Domains in SCOPe 2.04: d3ez4h_
  • Chain 'I':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: 721, 76, 808, BPSL2824, panB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63R49 (9-268)
      • expression tag (5-8)
    Domains in SCOPe 2.04: d3ez4i_
  • Chain 'J':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: 721, 76, 808, BPSL2824, panB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63R49 (9-268)
      • expression tag (7-8)
    Domains in SCOPe 2.04: d3ez4j_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ez4A (A:)
    mahhhhhhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgq
    attlpvtlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkle
    ggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeag
    aqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfm
    qgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ez4A (A:)
    hmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpvt
    lddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewlae
    tvrflveravpvcahvggaaqllrdaraveeagaqlivleavptlvaaevtrelsiptig
    igagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfpgpeh
    sf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ez4B (B:)
    mahhhhhhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgq
    attlpvtlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkle
    ggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeag
    aqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfm
    qgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ez4B (B:)
    mvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpvtl
    ddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewlaet
    vrflveravpvcahvglgaaqllrdaraveeagaqlivleavptlvaaevtrelsiptig
    igagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfpgpeh
    sf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ez4C (C:)
    mahhhhhhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgq
    attlpvtlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkle
    ggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeag
    aqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfm
    qgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ez4C (C:)
    hmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpvt
    lddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewlae
    tvrflveravpvcahvglgaaqllrdaraveeagaqlivleavptlvaaevtrelsipti
    gigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfpgpe
    hsf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ez4D (D:)
    mahhhhhhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgq
    attlpvtlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkle
    ggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeag
    aqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfm
    qgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ez4D (D:)
    hhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpv
    tlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewla
    etvrflveravpvcahvggaaqllrdaraveeagaqlivleavptlvaaevtrelsipti
    gigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfpgpe
    hs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ez4E (E:)
    mahhhhhhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgq
    attlpvtlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkle
    ggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeag
    aqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfm
    qgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ez4E (E:)
    hmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpvt
    lddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewlae
    tvrflveravpvcahvgagaaqllrdaraveeagaqlivleavptlvaaevtrelsipti
    gigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfpgpe
    hsf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ez4F (F:)
    mahhhhhhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgq
    attlpvtlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkle
    ggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeag
    aqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfm
    qgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ez4F (F:)
    hhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpv
    tlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewla
    etvrflveravpvcahvgleagaaqllrdaraveeagaqlivleavptlvaaevtrelsi
    ptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfp
    gpehsf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ez4G (G:)
    mahhhhhhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgq
    attlpvtlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkle
    ggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeag
    aqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfm
    qgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ez4G (G:)
    mvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpvtl
    ddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewlaet
    vrflveravpvcahvglaaqllrdaraveeagaqlivleavptlvaaevtrelsiptigi
    gagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfpgpehs
    f
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ez4H (H:)
    mahhhhhhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgq
    attlpvtlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkle
    ggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeag
    aqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfm
    qgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ez4H (H:)
    hmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpvt
    lddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewlae
    tvrflveravpvcahvglgkteagaaqllrdaraveeagaqlivleavptlvaaevtrel
    siptigigagaecsgqvlvlhdmlgvfrprfvkdfmqgqpsifaaveayvravkdgsfpg
    pehsf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3ez4I (I:)
    mahhhhhhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgq
    attlpvtlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkle
    ggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeag
    aqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfm
    qgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ez4I (I:)
    hhhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlp
    vtlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewl
    aetvrflveravpvcahvglagaaqllrdaraveeagaqlivleavptlvaaevtrelsi
    ptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfp
    gpehsf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ez4J (J:)
    mahhhhhhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgq
    attlpvtlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkle
    ggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeag
    aqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfm
    qgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ez4J (J:)
    hmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpvt
    lddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewlae
    tvrflveravpvcahvgagaaqllrdaraveeagaqlivleavptlvaaevtrelsipti
    gigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfpgpe
    hsf