SCOPe 2.08: Structural Classification of Proteins

PDB entry 3ez4

View 3ez4 on RCSB PDB site
Description: Crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from Burkholderia pseudomallei
Class: transferase
Keywords: Cytoplasm, Magnesium, Metal-binding, Methyltransferase, Pantothenate biosynthesis, Transferase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2008-10-22, released 2008-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia pseudomallei [TaxId:28450]
Gene: 721, 76, 808, BPSL2824, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q63R49 (9-268)
  - expression tag (7-8)
Domains in SCOPe 2.08: d3ez4a1, d3ez4a2
Chain 'B':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia pseudomallei [TaxId:28450]
Gene: 721, 76, 808, BPSL2824, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q63R49 (9-268)
  - expression tag (8)
Domains in SCOPe 2.08: d3ez4b1, d3ez4b2
Chain 'C':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia pseudomallei [TaxId:28450]
Gene: 721, 76, 808, BPSL2824, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q63R49 (9-268)
  - expression tag (7-8)
Domains in SCOPe 2.08: d3ez4c1, d3ez4c2
Chain 'D':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia pseudomallei [TaxId:28450]
Gene: 721, 76, 808, BPSL2824, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q63R49 (9-End)
  - expression tag (6-8)
Domains in SCOPe 2.08: d3ez4d1, d3ez4d2
Chain 'E':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia pseudomallei [TaxId:28450]
Gene: 721, 76, 808, BPSL2824, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q63R49 (9-268)
  - expression tag (7-8)
Domains in SCOPe 2.08: d3ez4e1, d3ez4e2
Chain 'F':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia pseudomallei [TaxId:28450]
Gene: 721, 76, 808, BPSL2824, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q63R49 (9-268)
  - expression tag (6-8)
Domains in SCOPe 2.08: d3ez4f1, d3ez4f2
Chain 'G':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia pseudomallei [TaxId:28450]
Gene: 721, 76, 808, BPSL2824, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q63R49 (9-268)
  - expression tag (8)
Domains in SCOPe 2.08: d3ez4g1, d3ez4g2
Chain 'H':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia pseudomallei [TaxId:28450]
Gene: 721, 76, 808, BPSL2824, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q63R49 (9-268)
  - expression tag (7-8)
Domains in SCOPe 2.08: d3ez4h1, d3ez4h2
Chain 'I':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia pseudomallei [TaxId:28450]
Gene: 721, 76, 808, BPSL2824, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q63R49 (9-268)
  - expression tag (5-8)
Domains in SCOPe 2.08: d3ez4i1, d3ez4i2
Chain 'J':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia pseudomallei [TaxId:28450]
Gene: 721, 76, 808, BPSL2824, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q63R49 (9-268)
  - expression tag (7-8)
Domains in SCOPe 2.08: d3ez4j1, d3ez4j2
Heterogens: TRS, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3ez4A (A:)
mahhhhhhmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgq
attlpvtlddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkle
ggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeag
aqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfm
qgqpsifaaveayvravkdgsfpgpehsf