PDB entry 3eyj

View 3eyj on RCSB PDB site
Description: Structure of Influenza Haemagglutinin in complex with an inhibitor of membrane fusion
Class: viral protein
Keywords: Influenza, hemagglutinin, inhibitor, Envelope protein, Fusion protein, Glycoprotein, Lipoprotein, Membrane, Palmitate, Transmembrane, Virion, VIRAL PROTEIN
Deposited on 2008-10-21, released 2009-01-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-01-13, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3eyja_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eyjA (A:)
    gnpiiclghhavengtsvktltdnhvevvsakelvetkhtdelcpsplklvdgqdcdlin
    galgspgcdrlqdttwdvfierptavdtcypfdvpdyqslrsilassgslefiaeqftwn
    gvkvdgsssaclrggrnsffsrlnwltkatngnygpinvtkentgsyvrlylwgvhhpss
    dneqtdlykvatgrvtvstrsdqisivpnigsrprvrnqsgrisiywtlvnpgdsiifns
    ignliaprghykiskstkstvlksdkrigsctspcltdkgsiqsdkpfqnvsriaigncp
    kyvkqgslmlatgmrnipgkqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eyjA (A:)
    gnpiiclghhavengtsvktltdnhvevvsakelvetkhtdelcpsplklvdgqdcdlin
    galgspgcdrlqdttwdvfierptavdtcypfdvpdyqslrsilassgslefiaeqftwn
    gvkvdgsssaclrggrnsffsrlnwltkatngnygpinvtkentgsyvrlylwgvhhpss
    dneqtdlykvatgrvtvstrsdqisivpnigsrprvrnqsgrisiywtlvnpgdsiifns
    ignliaprghykiskstkstvlksdkrigsctspcltdkgsiqsdkpfqnvsriaigncp
    kyvkqgslmlatgmrnipg
    

  • Chain 'B':
    No sequence available.