PDB entry 3eye

View 3eye on RCSB PDB site
Description: Crystal structure of PTS system N-acetylgalactosamine-specific IIB component 1 from Escherichia coli
Class: transferase
Keywords: STRUCTURAL GENOMICS, PHOSPHOTRANSFERASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE
Deposited on 2008-10-20, released 2008-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PTS system N-acetylgalactosamine-specific IIB component 1
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: agaB, ECs4018, Z4492
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3eyea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3eyeA (A:)
mslsspnilltridnrlvhgqvgvtwtstiganllvvvddvvanddiqqklmgitaetyg
fgirfftiektinvigkaaphqkiflicrtpqtvrklveggidlkdvnvgnmhfsegkkq
isskvyvddqdltdlrfikqrgvnvfiqdvpgdqkeqipdeghhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3eyeA (A:)
nilltridnrlvhgqvgvtwtstiganllvvvddvvanddiqqklmgitaetygfgirff
tiektinvigkaaphqkiflicrtpqtvrklveggidlkdvnvgnmhfsegkkqisskvy
vddqdltdlrfikqrgvnvfiqdvpgdqkeqip