PDB entry 3eyc

View 3eyc on RCSB PDB site
Description: New crystal structure of human tear lipocalin in complex with 1,4-butanediol in space group P21
Class: transport protein
Keywords: transport protein, ligand-binding protein, beta-barrel, Secreted, Sensory transduction, Taste, Transport
Deposited on 2008-10-20, released 2009-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipocalin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31025
      • engineered (96)
    Domains in SCOPe 2.08: d3eyca_
  • Chain 'B':
    Compound: Lipocalin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31025
      • engineered (96)
    Domains in SCOPe 2.08: d3eycb_
  • Chain 'C':
    Compound: Lipocalin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31025
      • engineered (96)
    Domains in SCOPe 2.08: d3eycc_
  • Chain 'D':
    Compound: Lipocalin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: LCN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31025
      • engineered (96)
    Domains in SCOPe 2.08: d3eycd_
  • Heterogens: BU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eycA (A:)
    asdeeiqdvsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqev
    kavlektdepgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnl
    ealedfekaagarglstesiliprqsetcspgsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eycA (A:)
    vsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqevkavlektd
    epgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnlealedfek
    aagarglstesiliprqsetcsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eycB (B:)
    asdeeiqdvsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqev
    kavlektdepgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnl
    ealedfekaagarglstesiliprqsetcspgsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eycB (B:)
    dvsgtwylkamtvdrefpemnlesvtpmtlttlnleakvtmlisgrcqevkavlektdep
    gkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnlealedfekaa
    garglstesiliprqsetcs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3eycC (C:)
    asdeeiqdvsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqev
    kavlektdepgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnl
    ealedfekaagarglstesiliprqsetcspgsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eycC (C:)
    dvsgtwylkamtvdremnlesvtpmtlttleggnleakvtmlisgrcqevkavlektdep
    gkytadggkhvayiirshvkdhyifysegekpvrgvklvgrdpknnlealedfekaagar
    glstesiliprqsetcs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3eycD (D:)
    asdeeiqdvsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqev
    kavlektdepgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnl
    ealedfekaagarglstesiliprqsetcspgsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eycD (D:)
    vsgtwylkamtvdrefnlesvtpmtlttleggnleakvtmlisgrcqevkavlektdepg
    kytadggkhvayiirshvkdhyifysegelkpvrgvklvgrdpknnlealedfekaagar
    glstesiliprqsetcs