PDB entry 3exv

View 3exv on RCSB PDB site
Description: Crystal structure of the human Adenovirus type 11 fiber knob
Class: viral protein
Keywords: adenovirus, fiber knob, attachment protein, trimer, CD46, MCP, Ad11, Fiber protein, VIRAL PROTEIN
Deposited on 2008-10-17, released 2008-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-01-13, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.194
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fiber protein
    Species: Human adenovirus B [TaxId:108098]
    Gene: PIV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3exva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3exvA (A:)
    gshmgltfnsnniciddnintlwtgvnpteancqimnssesndckliltlvktgalvtaf
    vyvigvsnnfnmltthrninftaelffdstgnlltrlsslktplnhksgqnmatgaitna
    kgfmpsttaypfndnsrekenyiygtcyytasdrtafpidisvmlnrraindetsyciri
    twswntgdapevqtsattlvtspftfyyiredd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exvA (A:)
    dnintlwtgvnpteancqimnssesndckliltlvktgalvtafvyvigvsnnfnmltth
    rninftaelffdstgnlltrlsslktplnhksgqnmatgaitnakgfmpsttaypfndns
    rekenyiygtcyytasdrtafpidisvmlnrraindetsyciritwswntgdapevqtsa
    ttlvtspftfyyiredd