PDB entry 3exr

View 3exr on RCSB PDB site
Description: Crystal structure of KGPDC from Streptococcus mutans
Class: lyase
Keywords: beta barrel, LYASE
Deposited on 2008-10-16, released 2009-08-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.208
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RmpD (Hexulose-6-phosphate synthase)
    Species: Streptococcus mutans [TaxId:1309]
    Gene: UlaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3exra_
  • Chain 'B':
    Compound: RmpD (Hexulose-6-phosphate synthase)
    Species: Streptococcus mutans [TaxId:1309]
    Gene: UlaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3exrb_
  • Chain 'C':
    Compound: RmpD (Hexulose-6-phosphate synthase)
    Species: Streptococcus mutans [TaxId:1309]
    Gene: UlaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3exrc_
  • Chain 'D':
    Compound: RmpD (Hexulose-6-phosphate synthase)
    Species: Streptococcus mutans [TaxId:1309]
    Gene: UlaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3exrd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3exrA (A:)
    mtkqlpnlqvaldhsnlkgaitaavsvgnevdvieagtvcllqvgselvevlrslfpdki
    ivadtkcadaggtvaknnavrgadwmtcicsatiptmkaarkaiedinpdkgeiqvelyg
    dwtydqaqqwldagisqaiyhqsrdallagetwgekdlnkvkkliemgfrvsvtgglsvd
    tlklfegvdvftfiagrgiteaknpagaarafkdeikriwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exrA (A:)
    kqlpnlqvaldhsnlkgaitaavsvgnevdvieagtvcllqvgselvevlrslfpdkiiv
    adtkcadaggtvaknnavrgadwmtcicsatiptmkaarkaiedinpdkgeiqvelygdw
    tydqaqqwldagisqaiyhqsrdallagetwgekdlnkvkkliemgfrvsvtgglsvdtl
    klfegvdvftfiagrgiteaknpagaarafkdeikriwg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3exrB (B:)
    mtkqlpnlqvaldhsnlkgaitaavsvgnevdvieagtvcllqvgselvevlrslfpdki
    ivadtkcadaggtvaknnavrgadwmtcicsatiptmkaarkaiedinpdkgeiqvelyg
    dwtydqaqqwldagisqaiyhqsrdallagetwgekdlnkvkkliemgfrvsvtgglsvd
    tlklfegvdvftfiagrgiteaknpagaarafkdeikriwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exrB (B:)
    qlpnlqvaldhsnlkgaitaavsvgnevdvieagtvcllqvgselvevlrslfpdkiiva
    dtkcadaggtvaknnavrgadwmtcicsatiptmkaarkaiedinpdkgeiqvelygdwt
    ydqaqqwldagisqaiyhqsretwgekdlnkvkkliemgfrvsvtgglsvdtlklfegvd
    vftfiagrgiteaknpagaarafkdeikriwg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3exrC (C:)
    mtkqlpnlqvaldhsnlkgaitaavsvgnevdvieagtvcllqvgselvevlrslfpdki
    ivadtkcadaggtvaknnavrgadwmtcicsatiptmkaarkaiedinpdkgeiqvelyg
    dwtydqaqqwldagisqaiyhqsrdallagetwgekdlnkvkkliemgfrvsvtgglsvd
    tlklfegvdvftfiagrgiteaknpagaarafkdeikriwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exrC (C:)
    qlpnlqvaldhsnlkgaitaavsvgnevdvieagtvcllqvgselvevlrslfpdkiiva
    dtkcadaggtvaknnavrgadwmtcicsatiptmkaarkaiedinpdkgeiqvelygdwt
    ydqaqqwldagisqaiyhqsrtwgekdlnkvkkliemgfrvsvtgglsvdtlklfegvdv
    ftfiagrgiteaknpagaarafkdeikriwg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3exrD (D:)
    mtkqlpnlqvaldhsnlkgaitaavsvgnevdvieagtvcllqvgselvevlrslfpdki
    ivadtkcadaggtvaknnavrgadwmtcicsatiptmkaarkaiedinpdkgeiqvelyg
    dwtydqaqqwldagisqaiyhqsrdallagetwgekdlnkvkkliemgfrvsvtgglsvd
    tlklfegvdvftfiagrgiteaknpagaarafkdeikriwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exrD (D:)
    qlpnlqvaldhsnlkgaitaavsvgnevdvieagtvcllqvgselvevlrslfpdkiiva
    dtkcadaggtvaknnavrgadwmtcicsatiptmkaarkaiedinpdkgeiqvelygdwt
    ydqaqqwldagisqaiyhqsrdallagetwgekdlnkvkkliemgfrvsvtgglsvdtlk
    lfegvdvftfiagrgiteaknpagaarafkdeikriwg