PDB entry 3exq

View 3exq on RCSB PDB site
Description: crystal structure of a nudix family hydrolase from lactobacillus brevis
Deposited on 2008-10-16, released 2008-11-04
The last revision was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NUDIX family hydrolase
    Species: Lactobacillus brevis ATCC 367 [TaxId:387344]
    Gene: LVIS_0842
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03S37 (3-152)
      • expression tag (2)
      • expression tag (153-160)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3exqA (A:)
msltrtqpvelvtmvmvtdpetqrvlvedkvnvpwkaghsfpgghvevgepcataairev
feetglrlsgvtfcgtcewfdddrqhrklgllyrasnftgtlkasaegqlswlpitaltr
ensaaslpeflqvftgtastlvsdswngnlrideghhhhhh

    Sequence, based on observed residues (ATOM records):
    >3exqA (A:)
ltrtqpvelvtmvmvtdpetqrvlvedkvnvpwkaghsfpgghvevgepcataairevfe
etglrlsgvtfcgtcewfdddrqhrklgllyrasnftgtlkasaegqlswlpitaltren
saaslpeflqvftgtastlvsdswngnlrideghhhhhh