PDB entry 3exh

View 3exh on RCSB PDB site
Description: Crystal structure of the pyruvate dehydrogenase (E1p) component of human pyruvate dehydrogenase complex
Class: oxidoreductase
Keywords: heterotetramer; thiamine diphosphate-dependent enzyme; Disease mutation; Glycolysis; Leigh syndrome; Mitochondrion; Oxidoreductase; Phosphoprotein; Alternative splicing; Polymorphism; Pyruvate; Thiamine pyrophosphate; Transit peptide, OXIDOREDUCTASE
Deposited on 2008-10-16, released 2008-11-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.167
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
      • engineered (291)
    Domains in SCOPe 2.03: d3exha_
  • Chain 'B':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3exhb1, d3exhb2
  • Chain 'C':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
      • engineered (223)
      • engineered (291)
    Domains in SCOPe 2.03: d3exhc_
  • Chain 'D':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3exhd1, d3exhd2
  • Chain 'E':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
    Domains in SCOPe 2.03: d3exhe_
  • Chain 'F':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3exhf1, d3exhf2
  • Chain 'G':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
      • engineered (223)
      • engineered (291)
    Domains in SCOPe 2.03: d3exhg_
  • Chain 'H':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3exhh1, d3exhh2
  • Heterogens: MN, K, TPP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3exhA (A:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exhA (A:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrygmgeraaastdyykrgdfipglrvdgmdilcvreatrfaaa
    ycrsgkgpilmelqtyryhghsmsdpgvayrtreeiqevrsksdpimllkdrmvnsnlas
    veelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exhB (B:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3exhC (C:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exhC (C:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrygmgtaveraaastdyykrgdfipglrvdgmdilcvreatrf
    aaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiqevrsksdpimllkdrmvnsn
    lasveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfks
    vs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exhD (D:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3exhE (E:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exhE (E:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennreraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrs
    gkgpilmelqtysksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpep
    pleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exhF (F:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3exhG (G:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exhG (G:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrygmgtaveraaastdyykrgdfipglrvdgmdilcvreatrf
    aaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiqevrsksdpimllkdrmvnsn
    lasveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfks
    vs
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exhH (H:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni