PDB entry 3exg

View 3exg on RCSB PDB site
Description: Crystal structure of the pyruvate dehydrogenase (E1p) component of human pyruvate dehydrogenase complex
Class: oxidoreductase
Keywords: heterotetramer; thiamine diphosphate-dependent enzyme; Disease mutation; Glycolysis; Leigh syndrome; Mitochondrion; Oxidoreductase; Phosphoprotein; Alternative splicing; Polymorphism; Pyruvate; Thiamine pyrophosphate; Transit peptide, OXIDOREDUCTASE
Deposited on 2008-10-16, released 2008-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
    Domains in SCOPe 2.07: d3exg11, d3exg12
  • Chain '2':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exg21, d3exg22
  • Chain '3':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
    Domains in SCOPe 2.07: d3exg31, d3exg32
  • Chain '4':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exg41, d3exg42
  • Chain '5':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
      • engineered (291)
    Domains in SCOPe 2.07: d3exg51, d3exg52
  • Chain '6':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exg61, d3exg62
  • Chain 'A':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
    Domains in SCOPe 2.07: d3exga1, d3exga2
  • Chain 'B':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgb1, d3exgb2
  • Chain 'C':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
    Domains in SCOPe 2.07: d3exgc1, d3exgc2
  • Chain 'D':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgd1, d3exgd2
  • Chain 'E':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
      • engineered (291)
    Domains in SCOPe 2.07: d3exge1, d3exge2
  • Chain 'F':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgf1, d3exgf2
  • Chain 'G':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
      • engineered (291)
    Domains in SCOPe 2.07: d3exgg1, d3exgg2
  • Chain 'H':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgh1, d3exgh2
  • Chain 'I':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
    Domains in SCOPe 2.07: d3exgi1, d3exgi2
  • Chain 'J':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgj1, d3exgj2
  • Chain 'K':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
      • engineered (291)
    Domains in SCOPe 2.07: d3exgk1, d3exgk2
  • Chain 'L':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgl1, d3exgl2
  • Chain 'M':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
      • engineered (291)
    Domains in SCOPe 2.07: d3exgm1, d3exgm2
  • Chain 'N':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgn1, d3exgn2
  • Chain 'O':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
    Domains in SCOPe 2.07: d3exgo1, d3exgo2
  • Chain 'P':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgp1, d3exgp2
  • Chain 'Q':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
    Domains in SCOPe 2.07: d3exgq1, d3exgq2
  • Chain 'R':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgr1, d3exgr2
  • Chain 'S':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgs_
  • Chain 'T':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgt1, d3exgt2
  • Chain 'U':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
      • engineered (291)
    Domains in SCOPe 2.07: d3exgu1, d3exgu2
  • Chain 'V':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgv1, d3exgv2
  • Chain 'W':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
      • engineered (291)
    Domains in SCOPe 2.07: d3exgw1, d3exgw2
  • Chain 'X':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgx1, d3exgx2
  • Chain 'Y':
    Compound: Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHA1, PHE1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08559 (21-381)
      • expression tag (20)
      • engineered (291)
    Domains in SCOPe 2.07: d3exgy1, d3exgy2
  • Chain 'Z':
    Compound: Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PDHB, PHE1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3exgz1, d3exgz2
  • Heterogens: K

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3exg1 (1:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exg1 (1:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsg
    kgpilmelqtyryevrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfata
    dpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exg2 (2:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >3exg3 (3:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exg3 (3:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennreraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrs
    gkgpilmelqtyrytreeiqevrsksdpimllkdrmvnsnlasveelkeidvevrkeied
    aaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exg4 (4:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >3exg5 (5:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exg5 (5:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsgk
    gpilmelqtyryhpgvayrtreeiqevrsksdpimllkdrmvnsnlasveelkeidvevr
    keiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain '6':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exg6 (6:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3exgA (A:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgA (A:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsg
    kgpilmelqtyryhtreeiqevrsksdpimllkdrmvnsnlasveelkeidvevrkeied
    aaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgB (B:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3exgC (C:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgC (C:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsg
    kgpilmelqtyryhtreeiqevrsksdpimllkdrmvnsnlasveelkeidvevrkeied
    aaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgD (D:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3exgE (E:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgE (E:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsg
    kgpilmelqtyryhdpgvayrtreeiqevrsksdpimllkdrmvnsnlasveelkeidve
    vrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgF (F:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3exgG (G:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgG (G:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsg
    kgpilmelqtyryhvayrtreeiqevrsksdpimllkdrmvnsnlasveelkeidvevrk
    eiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgH (H:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3exgI (I:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgI (I:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrveraaastdyykrgdfipglrvdgmdilcvreatrfaaaycr
    sgkgpilmelqtyryhtreeiqevrsksdpimllkdrmvnsnlasveelkeidvevrkei
    edaaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgJ (J:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3exgK (K:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgK (K:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsgk
    gpilmelqtyryhpgvayrtreeiqevrsksdpimllkdrmvnsnlasveelkeidvevr
    keiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgL (L:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3exgM (M:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgM (M:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsg
    kgpilmelqtyryhdpgvayrtreeiqevrsksdpimllkdrmvnsnlasveelkeidve
    vrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgN (N:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3exgO (O:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgO (O:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsgk
    gpilmelqtyevrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpe
    ppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgP (P:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3exgQ (Q:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgQ (Q:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrveraaastdyykrgdfipglrvdgmdilcvreatrfaaaycr
    sgkgpilmelqtyryhtreeiqevrsksdpimllkdrmvnsnlasveelkeidvevrkei
    edaaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgR (R:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3exgS (S:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgS (S:)
    fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg
    fchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakgk
    ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn
    maalwklpcificennraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsgkg
    pilmelqtyryhtreeiqevrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaa
    qfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgT (T:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3exgU (U:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgU (U:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsg
    kgpilmelqtyryhpgvayrtreeiqevrsksdpimllkdrmvnsnlasveelkeidvev
    rkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgV (V:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3exgW (W:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgW (W:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsg
    kgpilmelqtyryhayrtreeiqevrsksdpimllkdrmvnsnlasveelkeidvevrke
    iedaaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgX (X:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3exgY (Y:)
    mgsshhhhhhssglvprgshmfandatfeikkcdlhrleegppvttvltredglkyyrmm
    qtvrrmelkadqlykqkiirgfchlcdgqeaccvgleaginptdhlitayrahgftftrg
    lsvreilaeltgrkggcakgkggsmhmyaknfyggngivgaqvplgagialackyngkde
    vcltlygdgaanqgqifeaynmaalwklpcificennrygmgtaveraaastdyykrgdf
    ipglrvdgmdilcvreatrfaaaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiq
    evrsksdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
    yssdppfevrganqwikfksvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exgY (Y:)
    mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
    gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
    kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
    nmaalwklpcificennrraaastdyykrgdfipglrvdgmdilcvreatrfaaaycrsg
    kgpilmelqtyryhdpgvayrtreeiqevrsksdpimllkdrmvnsnlasveelkeidve
    vrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksvs
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3exgZ (Z:)
    lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
    gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
    sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
    efppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrt
    irpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadv
    pmpyakilednsipqvkdiifaikktlni