PDB entry 3exc

View 3exc on RCSB PDB site
Description: Structure of the RNA'se SSO8090 from Sulfolobus solfataricus
Class: hydrolase
Keywords: ferredoxin fold; double split beta-alpha-beta fold, dimer, catalytic aspartate, RNA'ase, HYDROLASE, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, PSI-2
Deposited on 2008-10-16, released 2008-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Uncharacterized protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SSO8090
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97Y85 (3-End)
      • engineered (41)
      • engineered (46)
    Domains in SCOPe 2.07: d3excx_
  • Heterogens: CL, NA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3excX (X:)
    fqgmkllvvydvsddskrnklannlkklgleriqrsafegdmdsqrmkdlvrvvklivdt
    ntdivhiiplgirdwerrivigregleewlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3excX (X:)
    mkllvvydvsddskrnklannlkklgleriqrsafegdmdrmkdlvrvvklivdtntdiv
    hiiplgirdwerrivigr