PDB entry 3exc

View 3exc on RCSB PDB site
Description: Structure of the RNA'se SSO8090 from Sulfolobus solfataricus
Class: hydrolase
Keywords: ferredoxin fold; double split beta-alpha-beta fold, dimer, catalytic aspartate, RNA'ase, HYDROLASE, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, PSI-2
Deposited on 2008-10-16, released 2008-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Uncharacterized protein
  Species: Sulfolobus solfataricus [TaxId:2287]
  Gene: SSO8090
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q97Y85 (3-End)
    • engineered (41)
    • engineered (46)
  Domains in SCOPe 2.08: d3excx_
• Heterogens: CL, NA, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence, based on SEQRES records: (download)
  

  >3excX (X:)
  fqgmkllvvydvsddskrnklannlkklgleriqrsafegdmdsqrmkdlvrvvklivdt
  ntdivhiiplgirdwerrivigregleewlv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3excX (X:)
  mkllvvydvsddskrnklannlkklgleriqrsafegdmdrmkdlvrvvklivdtntdiv
  hiiplgirdwerrivigr