PDB entry 3exb

View 3exb on RCSB PDB site
Description: Crystal structure of Cytochrome C Peroxidase with a Proposed Electron Pathway Excised in a Complex with a Peptide Wire
Class: oxidoreductase/peptide
Keywords: Oxidoreductase, Peroxidase, Heme, Hydrogen peroxide, Iron, Metal-binding, Mitochondrion, Transit peptide, OXIDOREDUCTASE-PEPTIDE COMPLEX
Deposited on 2008-10-16, released 2009-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.169
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (Start-294)
      • variant (55)
      • variant (154)
      • engineered (192-193)
    Domains in SCOPe 2.07: d3exba_
  • Chain 'B':
    Compound: n-[3-(1h-benzimidazol-1-yl)propanoyl]glycyl-l-alanyl-l-alaninamide
    Database cross-references and differences (RAF-indexed):
    • PDB 3EXB (0-End)
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3exbA (A:)
    mktttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtw
    dkhdntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavq
    emqgpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahal
    gkthlknsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysli
    qdpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3exbA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
    sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

  • Chain 'B':
    No sequence available.