PDB entry 3ex8

View 3ex8 on RCSB PDB site
Description: Complex structure of bacillus subtilis RibG reduction mechanism in riboflavin biosynthesis
Class: hydrolase, oxidoreductase
Keywords: alpha/beta/alpha, deaminase domain, reductase domain, Metal-binding, Multifunctional enzyme, NADP, Riboflavin biosynthesis, Zinc, HYDROLASE, OXIDOREDUCTASE
Deposited on 2008-10-16, released 2008-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.229
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin biosynthesis protein ribD
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU23280, ribD, ribG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ex8a1, d3ex8a2
  • Chain 'B':
    Compound: Riboflavin biosynthesis protein ribD
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU23280, ribD, ribG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ex8b1, d3ex8b2
  • Chain 'C':
    Compound: Riboflavin biosynthesis protein ribD
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU23280, ribD, ribG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ex8c1, d3ex8c2
  • Chain 'D':
    Compound: Riboflavin biosynthesis protein ribD
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU23280, ribD, ribG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17618 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.07: d3ex8d1, d3ex8d2, d3ex8d3
  • Heterogens: ZN, AIF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ex8A (A:)
    mrgshhhhhhgsmeeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygea
    haevhaihmagahaegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvag
    rgismmkeagievregiladqaerlnekflhfmrtglpyvtlkaaasldgkiatstgdsk
    witseaarqdaqqyrkthqsilvgvgtvkadnpsltcrlpnvtkqpvrvildtvlsiped
    akvicdqiaptwifttaradeekkkrlsafgvniftleteriqipdvlkilaeegimsvy
    veggsavhgsfvkegcfqeiifyfapkliggthapslisgegfqsmkdvpllqftditqi
    grdikltakptke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ex8A (A:)
    meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga
    haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie
    vregiladqaerlnekflhfmrtglpyvtlkaaasldgkiatstgdskwitseaarqdaq
    qyrkthqsilvgvgtvkadnpsltcrlpnvtkqpvrvildtvlsipedakvicdqiaptw
    ifttaradeekkkrlsafgvniftleteriqipdvlkilaeegimsvyveggsavhgsfv
    kegcfqeiifyfapkliggthapslisgegfqsmkdvpllqftditqigrdikltakpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ex8B (B:)
    mrgshhhhhhgsmeeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygea
    haevhaihmagahaegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvag
    rgismmkeagievregiladqaerlnekflhfmrtglpyvtlkaaasldgkiatstgdsk
    witseaarqdaqqyrkthqsilvgvgtvkadnpsltcrlpnvtkqpvrvildtvlsiped
    akvicdqiaptwifttaradeekkkrlsafgvniftleteriqipdvlkilaeegimsvy
    veggsavhgsfvkegcfqeiifyfapkliggthapslisgegfqsmkdvpllqftditqi
    grdikltakptke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ex8B (B:)
    meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga
    haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie
    vregiladqaerlnekflhfmrtglpyvtlkaaasldgkiatstgdskwitseaarqdaq
    qyrkthqsilvgvgtvkadnpsltcrlpnvtkqpvrvildtvlsipedakvicdqiaptw
    ifttaradeekkkrlsafgvniftleteriqipdvlkilaeegimsvyveggsavhgsfv
    kegcfqeiifyfapkliggthapslisgegfqsmkdvpllqftditqigrdikltakpt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ex8C (C:)
    mrgshhhhhhgsmeeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygea
    haevhaihmagahaegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvag
    rgismmkeagievregiladqaerlnekflhfmrtglpyvtlkaaasldgkiatstgdsk
    witseaarqdaqqyrkthqsilvgvgtvkadnpsltcrlpnvtkqpvrvildtvlsiped
    akvicdqiaptwifttaradeekkkrlsafgvniftleteriqipdvlkilaeegimsvy
    veggsavhgsfvkegcfqeiifyfapkliggthapslisgegfqsmkdvpllqftditqi
    grdikltakptke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ex8C (C:)
    meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga
    haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie
    vregiladqaerlnekflhfmrtglpyvtlkaaasldgkiatstgdskwitseaarqdaq
    qyrkthqsilvgvgtvkadnpsltcrlpnvtkqpvrvildtvlsipedakvicdqiaptw
    ifttaradeekkkrlsafgvniftleteriqipdvlkilaeegimsvyveggsavhgsfv
    kegcfqeiifyfapkliggthapslisgegfqsmkdvpllqftditqigrdikltakpt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ex8D (D:)
    mrgshhhhhhgsmeeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygea
    haevhaihmagahaegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvag
    rgismmkeagievregiladqaerlnekflhfmrtglpyvtlkaaasldgkiatstgdsk
    witseaarqdaqqyrkthqsilvgvgtvkadnpsltcrlpnvtkqpvrvildtvlsiped
    akvicdqiaptwifttaradeekkkrlsafgvniftleteriqipdvlkilaeegimsvy
    veggsavhgsfvkegcfqeiifyfapkliggthapslisgegfqsmkdvpllqftditqi
    grdikltakptke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ex8D (D:)
    smeeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmag
    ahaegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagi
    evregiladqaerlnekflhfmrtglpyvtlkaaasldgkiatstgdskwitseaarqda
    qqyrkthqsilvgvgtvkadnpsltcrlpnvtkqpvrvildtvlsipedakvicdqiapt
    wifttaradeekkkrlsafgvniftleteriqipdvlkilaeegimsvyveggsavhgsf
    vkegcfqeiifyfapkliggthapslisgegfqsmkdvpllqftditqigrdikltakpt