SCOPe 2.08: Structural Classification of Proteins

PDB entry 3ewr

View 3ewr on RCSB PDB site
Description: complex of substrate ADP-ribose with HCoV-229E Nsp3 ADRP domain
Class: hydrolase
Keywords: Globular like, Cytoplasm, Hydrolase, Membrane, Metal-binding, Protease, Ribosomal frameshifting, RNA-binding, Thiol protease, Transmembrane, Zinc, Zinc-finger
Deposited on 2008-10-16, released 2009-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-01-13, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.211
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: non-structural protein 3
Species: Human coronavirus 229E [TaxId:11137]
Database cross-references and differences (RAF-indexed):
- Uniprot P0C6U2 (0-End)
Domains in SCOPe 2.08: d3ewra_
Heterogens: APR, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3ewrA (A:)
keklnaflvhdnvafyqgdvdtvvngvdfdfivnaanenlahggglakaldvytkgklqr
lskehiglagkvkvgtgvmvecdslrifnvvgprkgkherdllikayntinneqgtpltp
ilscgifgikletslevlldvcntkevkvfvytdtevckvkdfvsglv

Sequence, based on observed residues (ATOM records): (download)

>3ewrA (A:)
keklnaflvhdnvafyqgdvdtvvngvdfdfivnaanenlahggglakaldvytkgklqr
lskehiglagkvkvgtgvmvecdslrifnvvgprkgkherdllikayntinneqgtpltp
ilscgifgikletslevlldvcntkevkvfvytdtevckvkdfvsgl