PDB entry 3ewk

View 3ewk on RCSB PDB site
Description: structure of the redox sensor domain of methylococcus capsulatus (bath) mmos
Deposited on 2008-10-15, released 2009-03-24
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein
    Species: Methylococcus capsulatus [TaxId:414]
    Gene: MCA1204, MmoS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FAD, GOL, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ewkA (A:)
lvsitdlqgrilyandnfcavsrygreelvgqdhrivnsgyhgkayirdmwrtisrgniw
qgefcnrrkdgtrywvdstivplmdnagkprqyisirrditaqkeaeaqlarlkqamdan
semilltdragriiyanpalcrfsgmaegellgqspsildspladqetlaamqealqagq
pwsgrllnrrrtgpaphdaedywaeisttpihtdgnglvgyvqiqhd