PDB entry 3ewi

View 3ewi on RCSB PDB site
Description: Structural analysis of the C-terminal domain of murine CMP-Sialic acid Synthetase
Class: transferase
Keywords: beta barrel, HAD-like, rossmannoid fold, Nucleotidyltransferase, Nucleus, Transferase
Deposited on 2008-10-15, released 2009-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acylneuraminate cytidylyltransferase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ewia_
  • Chain 'B':
    Compound: N-acylneuraminate cytidylyltransferase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ewib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ewiA (A:)
    gskeklkeikllvcnidgcltnghiyvsgdqkeiisydvkdaigisllkksgievrlise
    racskqtlsalkldcktevsvsdklatvdewrkemglcwkevaylgnevsdeeclkrvgl
    savpadacsgaqkavgyickcsggrgairefaehiflliekvnnscqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ewiA (A:)
    keikllvcnidgcltnghiyvsgdqkeiisydvkdaigisllkksgievrliseracskq
    tlsalkldcktevsvsdklatvdewrkemglcwkevaylgnevsdeeclkrvglsavpad
    acsgaqkavgyickcsggrgairefaehiflliekvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ewiB (B:)
    gskeklkeikllvcnidgcltnghiyvsgdqkeiisydvkdaigisllkksgievrlise
    racskqtlsalkldcktevsvsdklatvdewrkemglcwkevaylgnevsdeeclkrvgl
    savpadacsgaqkavgyickcsggrgairefaehiflliekvnnscqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ewiB (B:)
    eikllvcnidgcltnghiyvsgdqkeiisydvkdaigisllkksgievrliseracskqt
    lsalkldcktevsvsdklatvdewrkemglcwkevaylgnevsdeeclkrvglsavpada
    csgaqkavgyickcsggrgairefaehiflliekvnns