PDB entry 3ewg

View 3ewg on RCSB PDB site
Description: Crystal structure of the N-terminal domain of NusG (NGN) from Methanocaldococcus jannaschii
Deposited on 2008-10-15, released 2009-06-16
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcription antitermination protein nusG
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: NusG
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DIO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ewgA (A:)
mifavrtmvgqekniaglmasraekeqldvysilaseslkgyvlveaetkgdveelikgm
prvrgivpgtiaieeieplltpklehhhhhh

    Sequence, based on observed residues (ATOM records):
    >3ewgA (A:)
mifavrtmvgqekniaglmasraekeqldvysilaseslkgyvlveaetkgdveelikgm
prvrgivpgtiaieeiepll