PDB entry 3ew0

View 3ew0 on RCSB PDB site
Description: The novel 2Fe-2S outer mitochondrial protein mitoNEET displays conformational flexibility in its N-terminal cytoplasmic tethering domain
Class: metal binding protein
Keywords: mitochondrial outer membrane, 2Fe-2S proteins, isotopic labeling, highyield expression, Iron, Iron-sulfur, Membrane, Metal-binding, Mitochondrion, Mitochondrion outer membrane, Signal-anchor, Transmembrane, METAL BINDING PROTEIN
Deposited on 2008-10-13, released 2009-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CDGSH iron sulfur domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: C10orf70, CISD1, MDS029, ZCD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ45 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.08: d3ew0a1, d3ew0a2
  • Chain 'B':
    Compound: CDGSH iron sulfur domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: C10orf70, CISD1, MDS029, ZCD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ45 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d3ew0b1, d3ew0b2
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3ew0A (A:)
gsgmrfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgaht
khneetgdnvgpliikkket

    Sequence, based on observed residues (ATOM records): (download) 
    >3ew0A (A:)
gmrfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgahtkh
neetgdnvgpliikkke

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3ew0B (B:)
gsgmrfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgaht
khneetgdnvgpliikkket

    Sequence, based on observed residues (ATOM records): (download) 
    >3ew0B (B:)
gsgmrfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgaht
khneetgdnvgpliik