PDB entry 3evx

View 3evx on RCSB PDB site
Description: Crystal structure of the human E2-like ubiquitin-fold modifier conjugating enzyme 1 (Ufc1). Northeast Structural Genomics Consortium target HR41
Class: ligase
Keywords: alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Polymorphism, Ubl conjugation pathway, LIGASE
Deposited on 2008-10-13, released 2008-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ufm1-conjugating enzyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CGI-126, HSPC155, UFC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3evxa_
  • Chain 'B':
    Compound: Ufm1-conjugating enzyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CGI-126, HSPC155, UFC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3evxb_
  • Chain 'C':
    Compound: Ufm1-conjugating enzyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CGI-126, HSPC155, UFC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3evxc_
  • Chain 'D':
    Compound: Ufm1-conjugating enzyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CGI-126, HSPC155, UFC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3evxd_
  • Heterogens: SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3evxA (A:)
    madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
    egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
    fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3evxA (A:)
    atrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkegtr
    wfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfkpl
    warnvpkfglahlmalglgpwlaveipdliqkgviqhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3evxB (B:)
    madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
    egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
    fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3evxB (B:)
    atrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkegtr
    wfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfkpl
    warnvpkfglahlmalglgpwlaveipdliqkgviqhk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3evxC (C:)
    madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
    egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
    fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3evxC (C:)
    atrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkegtr
    wfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfkpl
    warnvpkfglahlmalglgpwlaveipdliqkgviqhk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3evxD (D:)
    madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
    egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
    fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3evxD (D:)
    atrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkegtr
    wfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfkpl
    warnvpkfglahlmalglgpwlaveipdliqkgviqhk