PDB entry 3evs

View 3evs on RCSB PDB site
Description: Crystal structure of the GDF-5:BMP receptor IB complex.
Class: CYTOKINE/Transferase Receptor
Keywords: ligand-receptor complex, cystin-knot ligand; three-finger toxn fold (receptor), Cleavage on pair of basic residues, Cytokine, Disease mutation, Dwarfism, Glycoprotein, Growth factor, Secreted, ATP-binding, Kinase, Magnesium, Manganese, Membrane, Metal-binding, Nucleotide-binding, Receptor, Serine/threonine-protein kinase, Transferase, Transmembrane, CYTOKINE-Transferase Receptor COMPLEX
Deposited on 2008-10-13, released 2009-03-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Growth/differentiation factor 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CDMP1, GDF5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3evsb_
  • Chain 'C':
    Compound: Bone morphogenetic protein receptor type-1B
    Species: Mus musculus [TaxId:10090]
    Gene: Acvrlk6, Bmpr1b
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3evsB (B:)
    mkrqgkrpsknlkarcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshlept
    nhaviqtlmnsmdpestpptccvptrlspisilfidsannvvykqyedmvvescgcr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3evsB (B:)
    arcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshleptnhaviqtlmnsmd
    pestpptccvptrlspisilfidsannvvykqyedmvvescgcr
    

  • Chain 'C':
    No sequence available.