PDB entry 3evi

View 3evi on RCSB PDB site
Description: Crystal structure of the thioredoxin-fold domain of human phosducin-like protein 2
Deposited on 2008-10-13, released 2009-03-03
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.236
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosducin-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCL2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Phosducin-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PDCL2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PEG, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3eviA (A:)
kfgelreisgnqyvnevtnaeedvwviihlyrssipmcllvnqhlsllarkfpetkfvka
ivnsciqhyhdnclptifvykngqieakfigiiecgginlkleelewklaevgaiqtd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3eviB (B:)
kfgelreisgnqyvnevtnaeedvwviihlyrssipmcllvnqhlsllarkfpetkfvka
ivnsciqhyhdnclptifvykngqieakfigiiecgginlkleelewklaevgaiqtd