PDB entry 3euu

View 3euu on RCSB PDB site
Description: Crystal structure of the FGFR2 D2 domain
Class: Transferase
Keywords: Ig-like, Alternative splicing, ATP-binding, Cell membrane, Craniosynostosis, Disease mutation, Ectodermal dysplasia, Glycoprotein, Heparin-binding, Immunoglobulin domain, Kinase, Lacrimo-auriculo-dento-digital syndrome, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Receptor, Secreted, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2008-10-10, released 2009-08-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.186
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KGFR, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3euua_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KGFR, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3euub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3euuA (A:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3euuB (B:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv