PDB entry 3eur

View 3eur on RCSB PDB site
Description: Crystal structure of the C-terminal domain of uncharacterized protein from Bacteroides fragilis NCTC 9343
Class: structural genomics, unknown function
Keywords: PSI2,MCSG, conserved protein, Structural Genomics, Protein Structure Initiative, Midwest Center for Structural Genomics, unknown function
Deposited on 2008-10-10, released 2008-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.14
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: BACTEROIDES FRAGILIS [TaxId:272559]
    Gene: BF1587
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LF10 (3-141)
      • expression tag (2)
    Domains in SCOPe 2.08: d3eura1, d3eura2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3eurA (A:)
snaknrlgtkalnftytldsgvkgtlyqfpaeytllfinnpgchacaemieglkaspvin
gftaakklkvlsiypdeeldewkkhrndfakewtngydkelviknknlydlraiptlyll
dknktvllkdatlqkveqylae

    Sequence, based on observed residues (ATOM records): (download) 
    >3eurA (A:)
aknrlgtkalnftytldsgvkgtlyqfpaeytllfinnpgchacaemieglkaspvingf
taakklkvlsiypdeeldewkkhrndfakewtngydkelviknknlydlraiptlylldk
nktvllkdatlqkveqylae