PDB entry 3euc

View 3euc on RCSB PDB site
Description: Crystal structure of histidinol-phosphate aminotransferase (YP_297314.1) from RALSTONIA EUTROPHA JMP134 at 2.05 A resolution
Class: transferase
Keywords: YP_297314.1, histidinol-phosphate aminotransferase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Amino-acid biosynthesis, Aminotransferase, Histidine biosynthesis, Pyridoxal phosphate, Transferase, Aminotransferase class I and II
Deposited on 2008-10-09, released 2008-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase 2
    Species: Ralstonia eutropha JMP134 [TaxId:264198]
    Gene: YP_297314.1, hisC2, Reut_A3110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3euca_
  • Chain 'B':
    Compound: Histidinol-phosphate aminotransferase 2
    Species: Ralstonia eutropha JMP134 [TaxId:264198]
    Gene: YP_297314.1, hisC2, Reut_A3110
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46WL3 (1-End)
      • leader sequence (0)
    Domains in SCOPe 2.07: d3eucb1, d3eucb2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eucA (A:)
    gmsvvdpslieriirddvramgayhvpdshglvkldamenpyrlppalrselaarlgeva
    lnrypvpssealraklkevmqvpagmevllgngsdeiismlalaaarpgakvmapvpgfv
    myamsaqfaglefvgvplradftldrgamlaamaehqpaivylaypnnptgnlfdaadme
    aivraaqgsvcrslvvvdeayqpfaqeswmsrltdfgnllvmrtvsklglagirlgyvag
    dpqwleqldkvrppynvnvlteatalfalehvavldeqaaqlraersrvaegmaahggvt
    vfpsaanfllarvpdaaqtfdrllarkvliknvskmhpllanclrvtvstpeenaqflea
    faaslqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eucA (A:)
    svvdpslieriirddvramgayhvpdshglvkldamenpyrlppalrselaarlgevaln
    rypvpssealraklkevmqvpagmevllgngsdeiismlalaaarpgakvmapvpgfvmy
    amsaqfaglefvgvplradftldrgamlaamaehqpaivylaypnnptgnlfdaadmeai
    vraaqgsvcrslvvvdeayqpfaqeswmsrltdfgnllvmrtvsklglagirlgyvagdp
    qwleqldkvrppynvnvlteatalfalehvavldeqaaqlraersrvaegmaahggvtvf
    psaanfllarvpdaaqtfdrllarkvliknvskmhpllanclrvtvstpeenaqfleafa
    aslqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eucB (B:)
    gmsvvdpslieriirddvramgayhvpdshglvkldamenpyrlppalrselaarlgeva
    lnrypvpssealraklkevmqvpagmevllgngsdeiismlalaaarpgakvmapvpgfv
    myamsaqfaglefvgvplradftldrgamlaamaehqpaivylaypnnptgnlfdaadme
    aivraaqgsvcrslvvvdeayqpfaqeswmsrltdfgnllvmrtvsklglagirlgyvag
    dpqwleqldkvrppynvnvlteatalfalehvavldeqaaqlraersrvaegmaahggvt
    vfpsaanfllarvpdaaqtfdrllarkvliknvskmhpllanclrvtvstpeenaqflea
    faaslqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eucB (B:)
    gmsvvdpslieriirddvramgayhvpdshglvkldamenyrlppalrselaarlgevss
    ealraklkevmqvpagmevllgngsdeiismlalaaarpgakvmapvpgfvmyamsaqfa
    glefvgvplradftldrgamlaamaehqpaivylaypnnptgnlfdaadmeaivraaqgs
    vcrslvvvdeayqpfaqeswmsrltdfgnllvmrtvsklglagirlgyvagdpqwleqld
    kvrppynvnvlteatalfalehvavldeqaaqlraersrvaegmaahggvtvfpsaanfl
    larvpdaaqtfdrllarkvliknvskmhpllanclrvtvstpeenaqfleafaaslq