PDB entry 3eu9

View 3eu9 on RCSB PDB site
Description: The ankyrin repeat domain of Huntingtin interacting protein 14
Class: protein binding, methyl-lysine-binding protein
Keywords: epigenetics; ankyrin repeats; methyllyine binding; Huntingtin interacting protein 14, Acyltransferase, ANK repeat, Cytoplasmic vesicle, Golgi apparatus, Membrane, Metal-binding, Oncogene, Phosphoprotein, Transferase, Transmembrane, Zinc-finger, PROTEIN BINDING, methyl-lysine-binding protein
Deposited on 2008-10-09, released 2009-06-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.222
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Huntingtin-interacting protein 14
    Species: Homo sapiens [TaxId:9606]
    Gene: ZDHHC17, HIP14, HIP3, HYPH, KIAA0946, HSPC294
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IUH5 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3eu9a_
  • Chain 'B':
    Compound: Huntingtin-interacting protein 14
    Species: Homo sapiens [TaxId:9606]
    Gene: ZDHHC17, HIP14, HIP3, HYPH, KIAA0946, HSPC294
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3eu9b_
  • Chain 'C':
    Compound: Huntingtin-interacting protein 14
    Species: Homo sapiens [TaxId:9606]
    Gene: ZDHHC17, HIP14, HIP3, HYPH, KIAA0946, HSPC294
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3eu9c_
  • Heterogens: HIS, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eu9A (A:)
    hmthiddystwdivkatqygiyercrelveagydvrqpdkenvtllhwaainnridlvky
    yiskgaivdqlggdlnstplhwatrqghlsmvvqlmkygadpslidgegcscihlaaqfg
    htsivayliakgqdvdmmdqngmtplmwaayrthsvdptrllltfnvsvnlgdkyhknta
    lhwavlagnttvisllleaganvdaqnikgesaldlakqrknvwminhlqearqakgydn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eu9A (A:)
    mthiddystwdivkatqygiyercrelveagydvrqpdkenvtllhwaainnridlvkyy
    iskgaivdqlggdlnstplhwatrqghlsmvvqlmkygadpslidgegcscihlaaqfgh
    tsivayliakgqdvdmmdqngmtplmwaayrthsvdptrllltfnvsvnlgdkyhkntal
    hwavlagnttvisllleaganvdaqnikgesaldlakqrknvwminhlqear
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eu9B (B:)
    hmthiddystwdivkatqygiyercrelveagydvrqpdkenvtllhwaainnridlvky
    yiskgaivdqlggdlnstplhwatrqghlsmvvqlmkygadpslidgegcscihlaaqfg
    htsivayliakgqdvdmmdqngmtplmwaayrthsvdptrllltfnvsvnlgdkyhknta
    lhwavlagnttvisllleaganvdaqnikgesaldlakqrknvwminhlqearqakgydn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eu9B (B:)
    iddystwdivkatqygiyercrelveagydvrqpdkenvtllhwaainnridlvkyyisk
    gaivdqlggdlnstplhwatrqghlsmvvqlmkygadpslidgegcscihlaaqfghtsi
    vayliakgqdvdmmdqngmtplmwaayrthsvdptrllltfnvsvnlgdkyhkntalhwa
    vlagnttvisllleaganvdaqnikgesaldlakqrknvwminhlqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3eu9C (C:)
    hmthiddystwdivkatqygiyercrelveagydvrqpdkenvtllhwaainnridlvky
    yiskgaivdqlggdlnstplhwatrqghlsmvvqlmkygadpslidgegcscihlaaqfg
    htsivayliakgqdvdmmdqngmtplmwaayrthsvdptrllltfnvsvnlgdkyhknta
    lhwavlagnttvisllleaganvdaqnikgesaldlakqrknvwminhlqearqakgydn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eu9C (C:)
    wdivkatqygiyercrelveagydvrqpdkenvtllhwaainnridlvkyyiskgaivdq
    lggdlnstplhwatrqghlsmvvqlmkygadpslidgegcscihlaaqfghtsivaylia
    kgqdvdmmdqngmtplmwaayrthsvdptrllltfnvsvnlgdkyhkntalhwavlagnt
    tvisllleaganvdaqnikgesaldlakqrknvwminhlqearqak