PDB entry 3eu1

View 3eu1 on RCSB PDB site
Description: Crystal Structure determination of goat hemoglobin (Capra hircus) at 3 angstrom resolution
Class: Oxygen storage, Oxygen transport
Keywords: low oxygen affinity, Capra hircus, hemoglobin, allosteric mechanism, 2,3-Diphospho glycerate, Oxygen storage, Oxygen transport
Deposited on 2008-10-09, released 2009-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-10, with a file datestamp of 2009-11-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha-1/2
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eu1a_
  • Chain 'B':
    Compound: Hemoglobin subunit beta-A
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eu1b_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha-1/2
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eu1c_
  • Chain 'D':
    Compound: Hemoglobin subunit beta-A
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eu1d_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eu1A (A:)
    vlsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghge
    kvaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpa
    vhasldkflanvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eu1B (B:)
    mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk
    ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse
    ftpllqaefqkvvagvanalahryh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eu1C (C:)
    vlsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghge
    kvaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpa
    vhasldkflanvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eu1D (D:)
    mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk
    ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse
    ftpllqaefqkvvagvanalahryh