PDB entry 3ety

View 3ety on RCSB PDB site
Description: crystal structure of bacterial adhesin fada l14a mutant
Deposited on 2008-10-08, released 2008-12-02
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adhesin A
    Species: Fusobacterium nucleatum [TaxId:851]
    Gene: fadA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5I6B0 (0-110)
      • engineered mutation (13)
      • expression tag (111-118)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3etyA (A:)
atdaaslvgelqaadaeyqnlanqeearfneeraqadaarqalaqneqvynelsqraqrl
qaeantrfyksqyqelaskyedalkkleaemeqqkavisdfekiqalragnlehhhhhh

    Sequence, based on observed residues (ATOM records):
    >3etyA (A:)
aaslvgelqaadaeyqnlanqeearfneeraqadaarqalaqneqvynelsqraqrlqae
antrfyksqyqelaskyedalkkleaemeqqkavisdfekiqal