PDB entry 3etr

View 3etr on RCSB PDB site
Description: Crystal structure of xanthine oxidase in complex with lumazine
Class: oxidoreductase
Keywords: protein-ligand complex, enzyme catalysis, substrate orientation, 2Fe-2S, FAD, Flavoprotein, Iron, Iron-sulfur, Metal-binding, Molybdenum, NAD, Oxidoreductase, Peroxisome
Deposited on 2008-10-08, released 2009-01-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-01-27, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3etra1, d3etra2
  • Chain 'B':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3etrb1, d3etrb2
  • Chain 'C':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3etrc1, d3etrc2
  • Chain 'L':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3etrl1, d3etrl2
  • Chain 'M':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3etrm1, d3etrm2
  • Chain 'N':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3etrn1, d3etrn2
  • Heterogens: FES, FAD, MTE, MOS, LUZ, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3etrA (A:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3etrB (B:)
    pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
    ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
    svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
    llsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrt
    isalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltv
    lkklg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3etrC (C:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkfttlcvtgapgnc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3etrL (L:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfak
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3etrM (M:)
    pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
    ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
    svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
    llsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrt
    isalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltv
    lkklg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3etrN (N:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkfttlcvtgapgnc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3etrN (N:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkftt