PDB entry 3etq

View 3etq on RCSB PDB site
Description: X-ray structure of cysteine-free fragment of mHCN2 C-terminal region from amino acids 443-630 including C508N, C584S, and C601S mutations
Class: transport protein
Keywords: HCN, ion channel, cAMP, Cyclic nucleotide binding domain, beta roll, C-linker, cAMP-binding, Glycoprotein, Ion transport, Ionic channel, Membrane, Nucleotide-binding, Phosphoprotein, Potassium, Potassium channel, Potassium transport, Sodium, Sodium channel, Sodium transport, Transmembrane, Transport, Voltage-gated channel, TRANSPORT PROTEIN
Deposited on 2008-10-08, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Bcng2, Hac1, Hcn2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88703 (6-End)
      • engineered (71)
      • engineered (147)
      • engineered (164)
    Domains in SCOPe 2.07: d3etqa_
  • Chain 'B':
    Compound: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Bcng2, Hac1, Hcn2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88703
      • engineered (71)
      • engineered (147)
      • engineered (164)
    Domains in SCOPe 2.07: d3etqb_
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3etqA (A:)
    lvprgsdssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgeln
    gplreeivnfnnrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyf
    iqhgvvsvltkgnkemklsdgsyfgeislltrgrrtasvradtysrlyslsvdnfnevle
    eypmmrrafetvaidrldrigkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3etqA (A:)
    dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
    ivnfnnrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
    svltkgnkemklsdgsyfgeislltrgrrtasvradtysrlyslsvdnfnevleeypmmr
    rafetvaidrldri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3etqB (B:)
    lvprgsdssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgeln
    gplreeivnfnnrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyf
    iqhgvvsvltkgnkemklsdgsyfgeislltrgrrtasvradtysrlyslsvdnfnevle
    eypmmrrafetvaidrldrigkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3etqB (B:)
    ssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplreei
    vnfnnrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvvs
    vltknkemklsdgsyfgeislltrgrrtasvradtysrlyslsvdnfnevleeypmmrra
    fetvaidrldr