PDB entry 3etp

View 3etp on RCSB PDB site
Description: The crystal structure of the ligand-binding domain of the EphB2 receptor at 2.0 A resolution
Class: Transferase
Keywords: Eph receptor, tyrosine kinase, Alternative splicing, ATP-binding, Glycoprotein, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2008-10-08, released 2008-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ephrin type-b receptor 2
    Species: Mus musculus [TaxId:10090]
    Gene: Ephb2, Epth3, Nuk, Sek3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54763 (7-186)
      • expression tag (0-6)
      • see remark 999 (134)
    Domains in SCOPe 2.06: d3etpa1, d3etpa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3etpA (A:)
    amaisdpeetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnw
    lrtkfirrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwme
    npwvkvdtiaadesisqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrv
    fyrkcpr