PDB entry 3eta

View 3eta on RCSB PDB site
Description: Kinase domain of insulin receptor complexed with a pyrrolo pyridine inhibitor
Class: signaling protein, transferase
Keywords: ATP-binding, Carbohydrate metabolism, Cleavage on pair of basic residues, Diabetes mellitus, Disease mutation, Glycoprotein, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase, SIGNALING PROTEIN
Deposited on 2008-10-07, released 2009-05-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.203
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin receptor, kinase domain
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3etaa_
  • Chain 'B':
    Compound: insulin receptor, kinase domain
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3etab_
  • Heterogens: 351, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3etaA (A:)
    mkkghhhhhhgevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesasl
    rerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaenn
    pgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiy
    etdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqv
    lkfvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffh
    seenkapeseelemefe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3etaA (A:)
    evsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslrerieflneas
    vmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptlqem
    iqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkgkgl
    lpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdggyldq
    pdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhseenk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3etaB (B:)
    mkkghhhhhhgevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesasl
    rerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaenn
    pgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiy
    etdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqv
    lkfvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffh
    seenkapeseelemefe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3etaB (B:)
    evsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslrerieflneas
    vmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptlqem
    iqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkkgll
    pvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdggyldqp
    dncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhseenk