PDB entry 3et7

View 3et7 on RCSB PDB site
Description: Crystal structure of PYK2 complexed with PF-2318841
Class: signaling protein, transferase
Keywords: kinase, Alternative splicing, ATP-binding, Cell membrane, Cytoplasm, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Transferase, Tyrosine-protein kinase, SIGNALING PROTEIN
Deposited on 2008-10-07, released 2009-06-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.251
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein tyrosine kinase 2 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2B, FAK2, PYK2, RAFTK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3et7a_
  • Heterogens: 349, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3et7A (A:)
    pqygiaredvvlnrilgegffgevyegvytnhkgekinvavktckkdctldnkekfmsea
    vimknldhphivkligiieeeptwiimelypygelghylernknslkvltlvlyslqick
    amaylesincvhrdiavrnilvaspecvklgdfglsryiededyykasvtrlpikwmspe
    sinfrrfttasdvwmfavcmweilsfgkqpffwlenkdvigvlekgdrlpkpdlcppvly
    tlmtrcwdydpsdrprftelvcslsdvyqmekdiame
    

    Sequence, based on observed residues (ATOM records): (download)
    >3et7A (A:)
    giaredvvlnrilgegffgevyegvytnhkgekinvavktckkdctldnkekfmseavim
    knldhphivkligiieeeptwiimelypygelghylernknslkvltlvlyslqickama
    ylesincvhrdiavrnilvaspecvklgdfglsrtrlpikwmspesinfrrfttasdvwm
    favcmweilsfgkqpffwlenkdvigvlekgdrlpkpdlcppvlytlmtrcwdydpsdrp
    rftelvcslsdvyqmekdiam