PDB entry 3et2

View 3et2 on RCSB PDB site
Description: Structure of PPARdelta with 3-[5-Methoxy-1-(4-methoxy-benzenesulfonyl)-1H-indol-3-yl]-propionic acid
Class: transcription
Keywords: PPAR, PPARd, PPARdelta, Drug Discovery, Diabetes, adiponectin, metabolic disease, fragment-based drug discovery, scaffold-based drug discovery, Activator, Alternative splicing, DNA-binding, Metal-binding, Nucleus, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger, K.Zhang, Wed Oct 1 17:27:09 2008 on nod
Deposited on 2008-10-06, released 2009-02-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-17, with a file datestamp of 2009-02-13.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.188
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3et2a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3et2b_
  • Heterogens: ET1, 1BO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3et2A (A:)
    mkkghhhhhhgsqynpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvih
    dietlwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslf
    lndqvtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfef
    avkfnalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqy
    lfpkllqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3et2A (A:)
    vadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwvng
    lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
    asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
    iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvteha
    qmmqrikktetetslhpllqeiykdm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3et2B (B:)
    mkkghhhhhhgsqynpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvih
    dietlwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslf
    lndqvtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfef
    avkfnalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqy
    lfpkllqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3et2B (B:)
    adlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkvng
    lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
    asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
    iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvteha
    qmmqrikktetetslhpllqeiykdmy