PDB entry 3et0

View 3et0 on RCSB PDB site
Description: Structure of PPARgamma with 3-(5-Methoxy-1H-indol-3-yl)-propionic acid
Class: transcription
Keywords: PPAR, PPARg, PPARgamma, Drug Discovery, Diabetes, adiponectin, metabolic disease, fragment-based drug discovery, scaffold-based drug discovery, Activator, Alternative splicing, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphoprotein, Polymorphism, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger
Deposited on 2008-10-06, released 2009-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-17, with a file datestamp of 2009-02-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (21-291)
      • expression tag (20)
    Domains in SCOPe 2.07: d3et0a1, d3et0a2
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (21-End)
      • expression tag (20)
    Domains in SCOPe 2.07: d3et0b1, d3et0b2
  • Heterogens: ET0, GLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3et0A (A:)
    mgsshhhhhhssglvprgshmesadlralakhlydsyiksfpltkakarailtgkttdks
    pfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipg
    fvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfme
    pkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnh
    pessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3et0A (A:)
    mesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikev
    airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
    gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
    pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
    ktetdmslhpllqeiykdly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3et0B (B:)
    mgsshhhhhhssglvprgshmesadlralakhlydsyiksfpltkakarailtgkttdks
    pfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipg
    fvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfme
    pkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnh
    pessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3et0B (B:)
    mesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikev
    airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
    gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
    pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
    ktetdmslhpllqeiykdl