PDB entry 3esy

View 3esy on RCSB PDB site
Description: E16KE61K Flavodoxin from Anabaena
Class: electron transport
Keywords: ALPHA and BETA PROTEIN, Electron transport, Flavoprotein, FMN, Transport
Deposited on 2008-10-06, released 2009-02-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.191
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3E0 (Start-168)
      • engineered (15)
      • engineered (60)
    Domains in SCOPe 2.01: d3esya_
  • Chain 'B':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3E0 (Start-168)
      • engineered (15)
      • engineered (60)
    Domains in SCOPe 2.01: d3esyb_
  • Chain 'C':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3E0 (Start-168)
      • engineered (15)
      • engineered (60)
    Domains in SCOPe 2.01: d3esyc_
  • Chain 'D':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3E0 (Start-168)
      • engineered (15)
      • engineered (60)
    Domains in SCOPe 2.01: d3esyd_
  • Heterogens: FMN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3esyA (A:)
    skkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
    klqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3esyA (A:)
    kkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnigk
    lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
    tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3esyB (B:)
    skkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
    klqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3esyB (B:)
    kkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnigk
    lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
    tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3esyC (C:)
    skkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
    klqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3esyC (C:)
    kkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnigk
    lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
    tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3esyD (D:)
    skkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
    klqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3esyD (D:)
    kkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnigk
    lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
    tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl